Glutamate Receptor 6 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87512

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87512
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all GluR6/GRIK2 Antibodies »

Product Summary for Glutamate Receptor 6 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human Glutamate Receptor 6. Peptide sequence: LGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Glutamate Receptor 6 Antibody

Western Blot: Glutamate Receptor 6 Antibody [NBP2-87512]

Western Blot: Glutamate Receptor 6 Antibody [NBP2-87512]

Western Blot: Glutamate Receptor 6 Antibody [NBP2-87512] - Host: Rabbit. Target Name: GRIK2. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Glutamate Receptor 6 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GluR6/GRIK2

Glutamate receptors mediate most excitatory neurotransmission in the brain and play an important role in neural plasticity, neural development and neurodegeneration. Ionotropic glutamate receptors are categorized into NMDA receptors and kainate/AMPA receptors, both of which contain glutamategated, caution-specific ion channels. Kainate/AMPA receptors are co-localized with NMDA receptors in many synapses and consist of seven structurally related subunits designated GluR-1 to -7. The kainate/AMPA receptors are primarily responsible for the fast excitatory neuro-transmission by glutamate, whereas the NMDA receptors are functionally characterized by a slow kinetic and a high permeability for Ca2+ ions. The NMDA receptors consist of five subunits: epsilion 1, 2, 3, 4 and one zeta subunit. The zeta subunit is expressed throughout the brain stem, whereas the four epsilon subunits display limited distribution.

Long Name

Glutamate Receptor 6

Alternate Names

EAA4, GLR6, GluK2, GLUK6, MRT6

Gene Symbol

GRIK2

Additional GluR6/GRIK2 Products

Product Documents for Glutamate Receptor 6 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Glutamate Receptor 6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.