Glutathione Synthetase Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-03702

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-03702-100ul
NBP3-03702-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Glutathione Synthetase Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 373-474 of human Glutathione Synthetase (NP_000169.1). NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutathione Synthetase Antibody - Azide and BSA Free

Western Blot: Glutathione Synthetase AntibodyAzide and BSA Free [NBP3-03702]

Western Blot: Glutathione Synthetase AntibodyAzide and BSA Free [NBP3-03702]

Western Blot: Glutathione Synthetase Antibody [NBP3-03702] - Analysis of extracts of various cell lines, using Glutathione Synthetase (GSS) antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.analysis of extracts of various cell lines, using Glutathione Synthetase (GSS) antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702]

Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702]

Immunocytochemistry/Immunofluorescence: Glutathione Synthetase Antibody [NBP3-03702] - Analysis of PC-12 cells using Glutathione Synthetase (GSS) antibody at dilution of 1:150. Blue: DAPI for nuclear staining.
Western Blot: Glutathione Synthetase AntibodyAzide and BSA Free [NBP3-03702]

Western Blot: Glutathione Synthetase AntibodyAzide and BSA Free [NBP3-03702]

Western Blot: Glutathione Synthetase Antibody [NBP3-03702] - WB image submitted by a verified customer review.
View 1 more images

Applications for Glutathione Synthetase Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Reviewed Applications

Read 1 review rated 5 using NBP3-03702 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glutathione Synthetase

Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage byfree radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as ahomodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion ofgamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.(provided by RefSeq)

Alternate Names

EC 6.3.2.3, Glutathione synthase, glutathione synthetase, GSH synthetase, GSHS, GSH-S, MGC14098

Gene Symbol

GSS

Additional Glutathione Synthetase Products

Product Documents for Glutathione Synthetase Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Glutathione Synthetase Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.