GnRH Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89749

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89749
NBP1-89749-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all GnRH Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GnRH Antibody

Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749]

Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749]

Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749] - Staining of rat brain shows strong cytoplasmic positivity in neurons in anterior hypothalamus.
Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749]

Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749]

Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749] - Staining of human hypothalamus shows moderate cytoplasmic positivity in a subset of neurons.
Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749]

Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749]

Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749] - Staining of human cerebellum shows very weak positivity in neuronal processes.
View 1 more images

Applications for GnRH Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GnRH

Gonadotropin releasing hormone (GnRH), also known as luteinizing hormone releasing hormone (LHRH), is a key molecule in the regulation of reproduction in vertebrates. GnRH, a decapeptide, is produced by neurons in the medial basal hypothalamus (MBH) and secreted in a pulsatile manner into the cardiovascular system. The frequency and amplitude of GnRH pulses determine secretion of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary. Higher frequencies (greater than one pulse per hour) stimulate LH secretion while lower frequencies stimulate FSH secretion. The generation of GnRH pulses is effected by numerous stimuli, such as neural, hormonal and environmental. Therefore, behavioral and physiological conditions such as sleep, exercise, and stress can affect the GnRH pulses and cause a disruption of the normal cycle.Recent studies show that GnRH also has a role in mediating cancer. GnRH has been shown to inhibit the growth of human uterine leiomyloma cells by suppressing proliferation and inducing apoptosis. GnRH analogs have been used to treat a wide variety of reproductive cancers, although the side effects of using such compounds are often quite severe.

Alternate Names

GNRH, GnRH-associated peptide 1, gonadotropin-releasing hormone 1 (leutinizing-releasing hormone), gonadotropin-releasing hormone 1 (luteinizing-releasing hormone), GRH, LHRH, LNRH, luliberin I, Progonadoliberin I, progonadoliberin-1, prolactin release-inhibiting factor

Gene Symbol

Gnrh1

Additional GnRH Products

Product Documents for GnRH Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GnRH Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.