GPR154 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-91966

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-91966
NBP1-91966-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all GPR154 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GPR154 Antibody

Immunohistochemistry-Paraffin: GPR154 Antibody [NBP1-91966]

Immunohistochemistry-Paraffin: GPR154 Antibody [NBP1-91966]

Immunohistochemistry-Paraffin: GPR154 Antibody [NBP1-91966] - Staining of human small intestine shows strong positivity in enteroendocrine cells.

Applications for GPR154 Antibody

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPR154

The GPR154 gene codes a neuropeptide S receptor plasma membrane protein as it is part of the G protein-coupled receptor 1 family. The protein encoded by the GPR154 gene is active in signaling pathway in several tissues in a paracrine or autocrine fashion through mediation of inhibitory effects on cell growth. Nine isoforms of this protein exist: isoform 1: 371 amino acids long, 42 kDA; isoform 2: 305 amino acids long, 35 kDA; isoform 3: 390 amino acids long, 44 kDA; isoform 4: 377 amino acids long, 43 kDA; isoform 5: 366 amino acids long, 41 kDA; isoform 6: 158 amino acids long, 18 kDA; isoform 7: 136 amino acids long, 15 kDA; isoform 8: 143 amino acids long, 16 kDA; and isoform 9: 94 amino acids long, 10 kDA; It is known to be involved in the pathogenesis of asthma and other IgE-mediated diseases because of increased expression in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells. Research has investigated its role in asthma, panic disorder, dermatitis, rabies, eczema, inflammatory bowel disease, rheumatoid arthritis, schizophrenia, and attention deficit hyperactivity disorder as well. The GPR154 gene participates in GPCR downstream signaling and ligand binding through interactions with various genes such as: ADYC2, ADORA2A, ADORA2B, ADRB2, and AVPR1B.

Alternate Names

G protein-coupled receptor 154, G protein-coupled receptor for asthma susceptibility, GPR154NPSR, GPRAASRT2, G-protein coupled receptor 154, G-protein coupled receptor for asthma susceptibility, G-protein coupled receptor PGR14, neuropeptide S receptor, neuropeptide S receptor 1, PGR14VRR1, vasopressin receptor-related receptor 1

Entrez Gene IDs

387129 (Human)

Gene Symbol

NPSR1

UniProt

Q6W5P4 (Human)

Additional GPR154 Products

Product Documents for GPR154 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GPR154 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.