GTF2A2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55408

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-55408
NBP2-55408-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all GTF2A2 Antibodies »

Product Summary for GTF2A2 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GTF2A2 Antibody

Western Blot: GTF2A2 Antibody [NBP2-55408]

Western Blot: GTF2A2 Antibody [NBP2-55408]

Western Blot: GTF2A2 Antibody [NBP2-55408] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: GTF2A2 Antibody [NBP2-55408]

Immunocytochemistry/ Immunofluorescence: GTF2A2 Antibody [NBP2-55408]

Immunocytochemistry/Immunofluorescence: GTF2A2 Antibody [NBP2-55408] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Applications for GTF2A2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GTF2A2

Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM]

Alternate Names

General transcription factor IIA subunit 2, general transcription factor IIA, 2 (12kD subunit), general transcription factor IIA, 2, 12kDa, HsT18745, TF2A2, TFIIA, TFIIA p12 subunit, TFIIA-12, TFIIA-gamma, TFIIAS, Transcription initiation factor IIA gamma chain, transcription initiation factor IIA subunit 2

Gene Symbol

GTF2A2

Additional GTF2A2 Products

Product Documents for GTF2A2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GTF2A2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.