HBP1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10947

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10947-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all HBP1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HBP1 (NP_036389). Peptide sequence FSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HBP1 Antibody

Western Blot: HBP1 Antibody [NBP3-10947]

Western Blot: HBP1 Antibody [NBP3-10947]

Western Blot: HBP1 Antibody [NBP3-10947] - Western blot analysis of HBP1 in Human heart. Antibody dilution at 1 ug/mL

Applications for HBP1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HBP1

The HMG-box protein-1 (HBP1) is a member of the HMG family of transcription factors, which are characterized by the presence of a conserved protein motif, the high mobility group (HMG) 1 box, that mediates DNA binding. HBP1 binds to the tumor suppressor proteins Rb and p130 and initiates cell cycle arrest. Terminal cell differentiation requires this initial cell cycle arrest followed by the coordinated expression of genes defined as tissue-specifc markers. Along with initiating the commitment to cell differentiation, the continued activity of HBP1 abrogates the expression of tissue-specific genes by associating with the MyoD proteins. In muscle cell differentiation, the MyoD family of transcription factors, which include Myf5, MyoD and myogenein, induce the expression of these cell-type specific proteins and contribute to the development of cell phenotypes. The progression of terminal differentiation is, therefore, dependent on both a decrease in HBP1 activity and the corresponding activation of MyoD-induced gene transcription.

Alternate Names

FLJ16340, High mobility group box transcription factor 1, HMG box transcription factor 1, HMG box-containing protein 1, HMG-box containing protein 1, HMG-box transcription factor 1, USMCC2

Gene Symbol

HBP1

Additional HBP1 Products

Product Documents for HBP1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HBP1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.