Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-91328

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-91328
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human HS6ST3. Peptide sequence TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody

Western Blot: Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody [NBP1-91328]

Western Blot: Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody [NBP1-91328]

Western Blot: Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody [NBP1-91328] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3

Heparan sulfate is a highly sulfated polysaccharide that can be found on the cell surface and extracellular matrix. It is usually covalently attached to a protein core as the glycan component of a proteoglycan. Heparan sulfate interacts with a variety of proteins, such as growth factors, protease inhibitors, cytokines, lipoprotein lipase and viral envelope proteins, therefore playing roles in cell growth, cell differentiation, cell motility, blood coagulation, lipid metabolism and viral infection. Heparan sulfate consists of repeating residues of uronic acid and N-acetylglucosamine. The uronic acid residues can be sulfated at the 2-O position by heparan sulfate 2-O-sulfotransferase. The N-acetylglucosamine residues can be sulfated at N-, 3-O, and 6-O positions by N-deacetylase/N-sulfotransferases, heparan sulfate 3-O- and 6-O-sulfotransferases, respectively. However, the reactions catalyzed by these sulfotransferases are normally incomplete on the whole chain of heparan sulfate. As a result, heparan sulfate displays enormous sequence diversity that allows it to interact with a wide spectrum of proteins differently. Three heparan sulfate 6-O-sulfotransferases are found both in human and mouse possibly with overlapping substrate specificity. HS6ST3 is ubiquitously expressed while HS6ST1 and HS6ST2 are expressed primarily in the liver and brain/spleen, respectively. Mouse HS6ST3 has 94% amino acid sequence identity with the human ortholog.

Alternate Names

DKFZp761K2315, heparan sulfate 6-O-sulfotransferase 3

Gene Symbol

HS6ST3

UniProt

NP_703157 (Human)

Additional Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Products

Product Documents for Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.