HMGN2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84069

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84069-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all HMGN2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of HMGN2. Peptide sequence: MPKRKAEGDAKGDKTKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HMGN2 Antibody

Western Blot: HMGN2 Antibody [NBP2-84069]

Western Blot: HMGN2 Antibody [NBP2-84069]

Western Blot: HMGN2 Antibody [NBP2-84069] - WB Suggested Anti-Hmgn2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Liver

Applications for HMGN2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HMGN2

HMG17 (high mobility group transcription factor 17) is an 18 kD high mobility group chromosomal protein. This nuclear protein is common to all eukaryotes and is developmentally regulated. HMG17 binds DNA in a non-sequence specific manner and interacts with nucleosomes to modulate chromatin structure. HMG17 regulates the gene expression of p53, Hox transcription factors, and steroid hormone receptors (increases DNA binding affinity). Phosphorylation of HMG17 may interfere with nuclear localization and favor release from nuclei. HMG17 is upregulated by wild-type p53 and increases during embryogenesis and is downregulated during differentiation and development. This protein is modified by phosphorylation and acetylation. HMG17 interacts with nucleosomes and probably forms multi-unit complexes with unrelated proteins. The Poly6081 antibody recognizes human and mouse HMG17 and has been shown to be useful for Western blotting.

Alternate Names

High mobility group nucleosome-binding domain-containing protein 2, high-mobility group (nonhistone chromosomal) protein 17, high-mobility group nucleosomal binding domain 2, HMG17high mobility group protein N2, MGC5629, MGC88718, non-histone chromosomal protein HMG-17, nonhistone chromosomal protein HMG-17

Gene Symbol

HMGN2

Additional HMGN2 Products

Product Documents for HMGN2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HMGN2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.