HMGN2 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-04809

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-04809-100ul
NBP3-04809-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all HMGN2 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human HMGN2 (NP_005508.1). MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HMGN2 Antibody - BSA Free

Western Blot: HMGN2 AntibodyBSA Free [NBP3-04809]

Western Blot: HMGN2 AntibodyBSA Free [NBP3-04809]

Western Blot: HMGN2 Antibody [NBP3-04809] - Analysis of extracts of various cell lines, using HMGN2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Applications for HMGN2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HMGN2

HMG17 (high mobility group transcription factor 17) is an 18 kD high mobility group chromosomal protein. This nuclear protein is common to all eukaryotes and is developmentally regulated. HMG17 binds DNA in a non-sequence specific manner and interacts with nucleosomes to modulate chromatin structure. HMG17 regulates the gene expression of p53, Hox transcription factors, and steroid hormone receptors (increases DNA binding affinity). Phosphorylation of HMG17 may interfere with nuclear localization and favor release from nuclei. HMG17 is upregulated by wild-type p53 and increases during embryogenesis and is downregulated during differentiation and development. This protein is modified by phosphorylation and acetylation. HMG17 interacts with nucleosomes and probably forms multi-unit complexes with unrelated proteins. The Poly6081 antibody recognizes human and mouse HMG17 and has been shown to be useful for Western blotting.

Alternate Names

High mobility group nucleosome-binding domain-containing protein 2, high-mobility group (nonhistone chromosomal) protein 17, high-mobility group nucleosomal binding domain 2, HMG17high mobility group protein N2, MGC5629, MGC88718, non-histone chromosomal protein HMG-17, nonhistone chromosomal protein HMG-17

Gene Symbol

HMGN2

Additional HMGN2 Products

Product Documents for HMGN2 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for HMGN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.