hnRNP G Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79904

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-79904
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all hnRNP G Antibodies »

Product Specifications

Immunogen

The specific Immunogen is proprietary information. Peptide sequence SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for hnRNP G Antibody

Western Blot: hnRNP G Antibody [NBP1-79904]

Western Blot: hnRNP G Antibody [NBP1-79904]

Western Blot: hnRNP G Antibody [NBP1-79904] - Hela, Antibody Dilution: 1.0 ug/ml RBMX is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: hnRNP G Antibody [NBP1-79904]

Western Blot: hnRNP G Antibody [NBP1-79904]

Western Blot: hnRNP G Antibody [NBP1-79904] - Titration: 1.0 ug/ml Positive Control: OVCAR-3 Whole Cell.

Applications for hnRNP G Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP G

Heterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to mRNA transcription, pre-mRNA processing as well as mature mRNA transport to the cytoplasm and translation. They also bind heterogeneous nuclear RNA (hnRNA), which are the transcripts produced by RNA polymerase II. There are approximately 20 known hnRNP proteins, and their complexes are the major constituents of the spliceosome. The majority of hnRNP proteins components are localized to the nucleus; however some shuttle between the nucleus and the cytoplasm. hnRNP G is a glycoprotein, which was originally identified as an autoantigen from German shepherd dogs with lupus-like syndrome. The gene encoding hnRNP G is located on chromosome Xq26 and is ubiquitously expressed. It contains one RNP-consensus RNA binding domain (RBD) and is related to RBMY, which is involved in spermatogenesis, and hnRNP G-T, which is a testis specific protein. All three proteins interact with Tra2b and therefore, are involved in pre-mRNA splicing.

Alternate Names

Glycoprotein p43, heterogeneous nuclear ribonucleoprotein G, hnRNP G, hnRNP-G, HNRPG, RBMXP1, RBMXRT, RNA binding motif protein, X chromosome, RNA binding motif protein, X-linked, RNA-binding motif protein, X chromosome, RNMX

Gene Symbol

RBMX

UniProt

NP_002130 (Human)

Additional hnRNP G Products

Product Documents for hnRNP G Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for hnRNP G Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.