hnRNP K Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58067

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58067
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all hnRNP K Antibodies »

Product Summary for hnRNP K Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hnRNP K Antibody

Western Blot: hnRNP K Antibody [NBP2-58067]

Western Blot: hnRNP K Antibody [NBP2-58067]

Western Blot: hnRNP K Antibody [NBP2-58067] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: hnRNP K Antibody [NBP2-58067]

Immunocytochemistry/ Immunofluorescence: hnRNP K Antibody [NBP2-58067]

Immunocytochemistry/Immunofluorescence: hnRNP K Antibody [NBP2-58067] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Applications for hnRNP K Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP K

The hnRNP-K family of acidic nuclear proteins has been identified using a monoclonal antibody that distinguishes between quiescent and proliferating human keratinocytes. The family, which is composed of four major proteins (hnRNPs-K A, B, C and D) and their modified forms, is present in similar overall levels in quiescent and proliferating normal keratinocytes although clear differences were observed in the levels of some of the individual variants (1). hnRNP-K is an ancient RNA/DNA-binding protein that is involved in multiple processes that compose gene expression. The pleiotropic action of K protein reflects its ability to interact with different classes of factors, interactions that are regulated by extracellular signals (2). hnRNP-K has several different cellular roles including transcription, mRNA shuttling, RNA editing and translation. Several reports implicate hnRNP K having a role in tumorigenesis, for instance hnRNP K increases transcription of the oncogene c-myc and hnRNP K expression is regulated by the p53/MDM 2 pathway (3).

Alternate Names

dC-stretch binding protein, FLJ41122, heterogeneous nuclear ribonucleoprotein K, hnRNP K, transformation upregulated nuclear protein, Transformation up-regulated nuclear protein, TUNPHNRPKCSBP

Gene Symbol

HNRNPK

Additional hnRNP K Products

Product Documents for hnRNP K Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for hnRNP K Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.