hnRNP U Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48729

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-48729-25ul
NBP2-48729
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all hnRNP U Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: TEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hnRNP U Antibody

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-48729]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-48729]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-48729] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Immunohistochemistry: hnRNP U Antibody [NBP2-48729]

Immunohistochemistry: hnRNP U Antibody [NBP2-48729]

Immunohistochemistry: hnRNP U Antibody [NBP2-48729] - Staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-48729]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-48729]

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-48729] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
View 2 more images

Applications for hnRNP U Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP U

hnRNP U belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they form complexes with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. Cleavage occurs at the SALD site, resulting in a loss of DNA-binding activity and a concomitant detachment of this protein from nuclear structural sites. But this cleavage does not affect the function of the encoded protein in RNA metabolism. At least two alternatively spliced transcript variants have been identified for this gene.

Alternate Names

heterogeneous nuclear ribonucleoprotein U, heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A), hnRNP U, HNRPU, p120, p120 nuclear protein, pp120, SAFA, SAF-AhnRNPU, Scaffold attachment factor A, U21.1

Gene Symbol

HNRNPU

Additional hnRNP U Products

Product Documents for hnRNP U Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for hnRNP U Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.