HOX11 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84075

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84075-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all HOX11 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HOX11. Peptide sequence: EAFQKSLAQPLPADPLCVHNSSLFALQNLQPWSDDSTKITSVTSVASACE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HOX11 Antibody

Western Blot: HOX11 Antibody [NBP2-84075]

Western Blot: HOX11 Antibody [NBP2-84075]

Western Blot: HOX11 Antibody [NBP2-84075] - WB Suggested Anti-TLX1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart

Applications for HOX11 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOX11

HOX11, also called homeobox11 or Tcl-3 is located at the 10q24 T-Cell translocation breakpoint region. It encodes a homeobox-domain containing protein, HOX11, containing a glycine and proline-rich amino terminus. HOX11 is required for maintenance of the developing spleen and cell survival. The HOX11protein binds to a specific DNA sequence and localizes to the cell nucleus. It transactivates transcription of a reporter gene linked to a cis-regulatory element, acting as a positive transcription activator. The HOX11 gene is highly expressed in T-ALLs as a result of a t (7:10) (q35;q24) or t(10:14)(q24;qll) translocation. The homeobox gene is deregulated upon translocation into the T-cell receptor locus and activates a specific subset of tumor-associated target genes. HOX 11 gene translocation has been attributed to T-cell leukemia and lymphoid neoplasias.

Alternate Names

homeo box 11 (T-cell lymphoma 3-associated breakpoint), homeo box-11 (T-cell leukemia-3 associated breakpoint, homologous to DrosophilaNotch), Homeobox protein Hox-11, HOX11T-cell leukemia, homeobox 1, Proto-oncogene TCL-3, T-cell leukemia homeobox 1, T-cell leukemia homeobox protein 1, T-cell leukemia/lymphoma protein 3, TCL3MGC163402

Gene Symbol

TLX1

Additional HOX11 Products

Product Documents for HOX11 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HOX11 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.