Hyaluronan synthase 1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85085

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85085-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Hyaluronan synthase 1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Hyaluronan synthase 1. Peptide sequence: EPAAAGAVGAGAYREVEAEDPGRLAVEALVRTRRCVCVAQRWGGKREVMY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Hyaluronan synthase 1 Antibody

Western Blot: Hyaluronan synthase 1 Antibody [NBP2-85085]

Western Blot: Hyaluronan synthase 1 Antibody [NBP2-85085]

Western Blot: Hyaluronan synthase 1 Antibody [NBP2-85085] - WB Suggested Anti-HAS1 Antibody. Titration: 1.0 ug/ml. Positive Control: THP-1 Whole Cell
Western Blot: Hyaluronan synthase 1 Antibody [NBP2-85085]

Western Blot: Hyaluronan synthase 1 Antibody [NBP2-85085]

Western Blot: Hyaluronan synthase 1 Antibody [NBP2-85085] - Host: Rabbit. Target Name: HAS1. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 1ug/ml

Applications for Hyaluronan synthase 1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hyaluronan synthase 1

Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide varietyof organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternatingglucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. HA issynthesized by membrane-bound synthase at the inner surface of the plasma membrane, and the chains are extrudedthrough pore-like structures into the extracellular space. It serves a variety of functions, including space filling,lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during woundhealing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. Changes in the serumconcentration of HA are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. Inaddition, the interaction of HA with the leukocyte receptor CD44 is important in tissue-specific homing by leukocytes,and overexpression of HA receptors has been correlated with tumor metastasis. HAS1 is a member of the newly identifiedvertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homologyto the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and arecently described murine hyaluronan synthase. (provided by RefSeq)

Alternate Names

HA synthase 1, HAS, huHAS1, hyaluronan synthase 1, hyaluronate synthase 1, hyaluronic acid synthase 1

Gene Symbol

HAS1

Additional Hyaluronan synthase 1 Products

Product Documents for Hyaluronan synthase 1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Hyaluronan synthase 1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.