IGFLR1/TMEM149 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-24910

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-24910
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all IGFLR1 Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein IGFLR1/TMEM149 using the following amino acid sequence: LEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IGFLR1/TMEM149 Antibody

IGFLR1/TMEM149 Antibody Immunocytochemistry/Immunofluorescence: IGFLR1/TMEM149 Antibody [NBP3-24910]

Immunocytochemistry/Immunofluorescence: IGFLR1/TMEM149 Antibody [NBP3-24910]

Staining of human cell line HEL shows localization to nucleoplasm & plasma membrane.

Applications for IGFLR1/TMEM149 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, pH 7.2, 40% glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IGFLR1

Insulin Growth Factor-like Family Receptor 1 (IGFLR1) is a 355 amino acid (aa) type 1a transmembrane protein that was identified in a screen for binding partners of human IGFL-1. Mature human IGFLR1 consists of an extracellular domain (ECD) with two putative cysteine-rich domains (CRDs), a transmembrane region, and a cytoplasmic domain. Its structure has similarities to TNF receptor family members. Over the first 163 aa, human IGFLR1 shares 61% and 59% aa sequence identity with mouse and rat IGFLR1, respectively. In mice, IGFLR1 is expressed primarily on T cells and, similar to the human proteins, mouse IGFLR1 binds the mouse IGFL protein. Human IGFL-1 expression is enhanced by TNF-alpha treatment and was shown to be up-regulated in human psoriatic skin samples, suggesting that IGFLR1 may have a role during skin inflammation.

Long Name

IGF-like Family Receptor 1

Alternate Names

TMEM149, U2AF1L4

Gene Symbol

IGFLR1

Additional IGFLR1 Products

Product Documents for IGFLR1/TMEM149 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for IGFLR1/TMEM149 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.