IGHMBP2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-68921

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-68921
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all IGHMBP2 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to Ighmbp2 (immunoglobulin mu binding protein 2). The peptide sequence was selected from the N terminal of Ighmbp2. Peptide sequence QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

109 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for IGHMBP2 Antibody

Western Blot: IGHMBP2 Antibody [NBP1-68921]

Western Blot: IGHMBP2 Antibody [NBP1-68921]

Western Blot: IGHMBP2 Antibody [NBP1-68921] - Mouse Heart.
Immunocytochemistry/ Immunofluorescence: IGHMBP2 Antibody [NBP1-68921]

Immunocytochemistry/ Immunofluorescence: IGHMBP2 Antibody [NBP1-68921]

Immunocytochemistry/Immunofluorescence: IGHMBP2 Antibody [NBP1-68921] - IGHMBP2 in HEK293 cells. Antibody at 1:50. Image from verified customer review.

Applications for IGHMBP2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 4 using NBP1-68921 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IGHMBP2

Ighmbp2 is a 5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5'-GGGCT-3' motif. Ighmbp2 interacts with tRNA-Tyr.

Alternate Names

ATP-dependent helicase IGHMBP2, CATF1FLJ41171, EC 3.6.1, EC 3.6.4.12, EC 3.6.4.13, GF-1, Glial factor 1, HCSA, HMN6cardiac transcription factor 1, immunoglobulin mu binding protein 2, Immunoglobulin mu-binding protein 2, SMARD1DNA-binding protein SMUBP-2, SMBP2, SMUBP2FLJ34220

Gene Symbol

IGHMBP2

UniProt

P40694 (Mouse)

Additional IGHMBP2 Products

Product Documents for IGHMBP2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IGHMBP2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.