Skip to main content

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Alexa Fluor 647 (Excitation = 650 nm, Emission = 668 nm)

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 46N8G7

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for IL-17RE Antibody (46N8G7) [Alexa Fluor® 647]

Immunogen

amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Applications for IL-17RE Antibody (46N8G7) [Alexa Fluor® 647]

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: IL-17RE

Interleukin-17 Receptor E (IL-17 RE) is a transmembrane protein that is expressed on mucosal epithelial cells, keratinocytes, Th17 cells, and gamma delta T cells. It associates with IL-17 RA to form a heterodimeric receptor for IL-17C. Binding of IL-17C to this receptor complex promotes mucosal immunity by stimulating the production of anti-bacterial peptides and pro-inflammatory cytokines and chemokines. Additionally, IL-17C signaling regulates Th17 cell-dependent immune responses and has been suggested to contribute to psoriatic skin thickening, the progression of arthritis, and the pathogenesis of autoimmune diseases.

Long Name

Interleukin 17 Receptor E

Alternate Names

IL-17 RE, IL17RE, Il25r

Gene Symbol

IL17RE

Additional IL-17RE Products

Product Documents for IL-17RE Antibody (46N8G7) [Alexa Fluor® 647]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IL-17RE Antibody (46N8G7) [Alexa Fluor® 647]

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...