Skip to main content

Key Product Details

Species Reactivity

Human, Porcine

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Frozen, Western Blot

Label

DyLight 680 (Excitation = 692 nm, Emission = 712 nm)

Antibody Source

Monoclonal Mouse IgG1 Clone # 29A3

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the Integrin alpha 3/CD49c including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Reactivity Notes

A broad species reactivity is expected based on the conserved nature of the epitope. Use in Porcine reported in scientific literature (PMID:32211117).

Specificity

This antibody recognizes specifically the cytoplasmic domain of Integrin alpha 3/CD49c which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Description

This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Applications for Integrin alpha 3/CD49c Antibody (29A3) [DyLight 680]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Frozen

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined..
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Integrin alpha 3/CD49c

Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. The alpha 3 beta 1 integrin is known variously as: very late (activation) antigen 3 (VLA3), very common antigen 2 (VCA2), extracellular matrix receptor 1 (ECMR1), and galactoprotein b3 (GAPB3).

Alternate Names

CD49c, ITGA3

Gene Symbol

ITGA3

Additional Integrin alpha 3/CD49c Products

Product Documents for Integrin alpha 3/CD49c Antibody (29A3) [DyLight 680]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Integrin alpha 3/CD49c Antibody (29A3) [DyLight 680]



DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...