Intersectin 2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86680

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86680-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Intersectin 2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Intersectin 2. Peptide sequence: TFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDQESFGSASKSGA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Intersectin 2 Antibody

Western Blot: Intersectin 2 Antibody [NBP2-86680]

Western Blot: Intersectin 2 Antibody [NBP2-86680]

Western Blot: Intersectin 2 Antibody [NBP2-86680] - WB Suggested Anti-ITSN2 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell

Applications for Intersectin 2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Intersectin 2

Intersectin-2 is a cytoplasmic adapter protein that may provide a link between the actin assembly machinery and the endocytic membrance traffic, as well a control the production of clathrin-coated vesicles in terms of their invagination of budding. Intersectin-2 has four isoforms, with lengths of 1697, 1670, 1249, and 1192 amino acids and weights of 193, 190, 141, and 135 kDa respectively. Studies have been conducted on diseases and disorders related to this protein including Wiskott-Aldrich syndrome, dermatitis, sarcoma, schizophrenia, spasticity, pancreatitis, and pancreatic cancer. Intersectin-2 has also been known to have interactions with BCCIP, PTN, TBL3, MAP4K3, and SEMA6A in pathways such as the regulation of CDC42 activity pathway.

Alternate Names

intersectin 2, KIAA1256SH3 domain-containing protein 1B, PRO2015, SH3 domain protein 1B, SH3P18-like WASP associated protein, SH3P18SH3D1Bintersectin-2, SWA, SWAPSH3P18-like WASP-associated protein

Gene Symbol

ITSN2

Additional Intersectin 2 Products

Product Documents for Intersectin 2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Intersectin 2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.