Intra Acrosomal Protein Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79534

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-79534
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Intra Acrosomal Protein Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human ACRV1. Peptide sequence MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Intra Acrosomal Protein Antibody

Western Blot: Intra Acrosomal Protein Antibody [NBP1-79534]

Western Blot: Intra Acrosomal Protein Antibody [NBP1-79534]

Western Blot: Intra Acrosomal Protein Antibody [NBP1-79534] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Applications for Intra Acrosomal Protein Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Intra Acrosomal Protein

Intra Acrosomal Protein is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The gene encoding this protein consists of 4 exons and its alternative splicing generates 11 distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining 7 transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Alternate Names

acrosomal protein SP-10, acrosomal vesicle protein 1D11S4365, SP-10, SPACA2, sperm protein 10

Gene Symbol

ACRV1

UniProt

NP_001603 (Human)

Additional Intra Acrosomal Protein Products

Product Documents for Intra Acrosomal Protein Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Intra Acrosomal Protein Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.