Intra Acrosomal Protein Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-34054

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-34054
NBP2-34054-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Intra Acrosomal Protein Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: TSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Intra Acrosomal Protein Antibody

Western Blot: Intra Acrosomal Protein Antibody [NBP2-34054]

Western Blot: Intra Acrosomal Protein Antibody [NBP2-34054]

Western Blot: Intra Acrosomal Protein Antibody [NBP2-34054] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Testis
Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054]

Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054]

Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054]

Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054]

Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054] - Staining of human endometrium shows low expression as expected.
View 5 more images

Applications for Intra Acrosomal Protein Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Intra Acrosomal Protein

Intra Acrosomal Protein is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The gene encoding this protein consists of 4 exons and its alternative splicing generates 11 distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining 7 transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Alternate Names

acrosomal protein SP-10, acrosomal vesicle protein 1D11S4365, SP-10, SPACA2, sperm protein 10

Gene Symbol

ACRV1

UniProt

P26436 (Human)

Additional Intra Acrosomal Protein Products

Product Documents for Intra Acrosomal Protein Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Intra Acrosomal Protein Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.