JTB Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-81746

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-81746
NBP1-81746-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all JTB Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for JTB Antibody

Western Blot: JTB Antibody [NBP1-81746]

Western Blot: JTB Antibody [NBP1-81746]

Western Blot: JTB Antibody [NBP1-81746] - Analysis in control (vector only transfected HEK293T lysate) and JTB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: JTB Antibody [NBP1-81746]

Immunocytochemistry/ Immunofluorescence: JTB Antibody [NBP1-81746]

Immunocytochemistry/Immunofluorescence: JTB Antibody [NBP1-81746] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: JTB Antibody [NBP1-81746]

Immunohistochemistry-Paraffin: JTB Antibody [NBP1-81746]

Immunohistochemistry-Paraffin: JTB Antibody [NBP1-81746] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Applications for JTB Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: JTB

JTB, also known as Protein JTB, has a 146 amino acid long isoform that is 16 kDa and a short 117 amino acid that is 13 kDa; needed for normal cytokinesis during mitosis, participates in the regulation of cell proliferation, may be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly, fosters AURKB activity, its overexpression induces swelling of mitochondria and reduces mitochondrial membrane potential. Disease research is currently being studied with relation to JTB and lymph node tuberculosis, tuberculous meningitis, abdominal tuberculosis, prostatitis, hepatocellular carcinoma, carcinoma, and adenoid cystic carcinoma. The protein has been shown to interact with AURKA, AURKB, BIRC5, INCENP, and LIG3 proteins in apoptotic process, regulation of cell proliferation, cell cycle cytokinesis, mitosis, and cell cycle pathways.

Long Name

Jumping Translocation Breakpoint

Alternate Names

Gm622, HSPC222, PAR Protein

Gene Symbol

JTB

Additional JTB Products

Product Documents for JTB Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for JTB Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.