KCNMB4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56583

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-56583
NBP2-56583-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all KCNMB4 Antibodies »

Product Summary for KCNMB4 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KCNMB4 Antibody

Immunocytochemistry/ Immunofluorescence: KCNMB4 Antibody [NBP2-56583]

Immunocytochemistry/ Immunofluorescence: KCNMB4 Antibody [NBP2-56583]

Immunocytochemistry/Immunofluorescence: KCNMB4 Antibody [NBP2-56583] - Staining of human cell line RT4 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KCNMB4 Antibody [NBP2-56583]

Immunohistochemistry-Paraffin: KCNMB4 Antibody [NBP2-56583]

Immunohistochemistry-Paraffin: KCNMB4 Antibody [NBP2-56583] - Staining in human cerebral cortex and pancreas tissues using anti-KCNMB4 antibody. Corresponding KCNMB4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: KCNMB4 Antibody [NBP2-56583]

Immunohistochemistry-Paraffin: KCNMB4 Antibody [NBP2-56583]

Immunohistochemistry-Paraffin: KCNMB4 Antibody [NBP2-56583] - Staining of human cerebral cortex shows high expression.
View 1 more images

Applications for KCNMB4 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNMB4

KCNMB4, also known as Calcium-activated potassium channel subunit beta-4, is a 210 amino acid protein that is 34 kDa; predominantly expressed in brain; regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channels which are fundamental to the control of smooth muscle tone and neuronal excitability; is an auxiliary beta subunit which slows activation kinetics, leads to steeper calcium sensitivity, and shifts the voltage range of current activation to more negative potentials than does the beta 1 subunit. Current research is being pursued on this protein involvement in several diseases and disorders including neurological disorder, corpus callosum, epilepsy syndrome, seizures, neuronitis, and cerebritis. This protein has been linked to the hemostasis, potassium channels, Ca2+ activated K+ channels, cGMP effects, platelet homeostasis, synaptic transmission- ion currents, and vascular smooth muscle contraction.

Alternate Names

BK channel subunit beta-4, BKbeta4, calcium-activated potassium channel subunit beta-4, Calcium-activated potassium channel, subfamily M subunit beta-4, Charybdotoxin receptor subunit beta-4, hbeta4, k(VCA)beta-4, large conductance calcium-dependent potassium ion channel beta 4 subunit, Maxi K channel subunit beta-4, potassium large conductance calcium-activated channel, subfamily M, beta member4, slo-beta-4

Gene Symbol

KCNMB4

Additional KCNMB4 Products

Product Documents for KCNMB4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for KCNMB4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.