Kv6.1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-81572

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-81572
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Kv6.1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Kv6.1 Antibody

Western Blot: Kv6.1 Antibody [NBP1-81572]

Western Blot: Kv6.1 Antibody [NBP1-81572]

Western Blot: Kv6.1 Antibody [NBP1-81572] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: Kv6.1 Antibody [NBP1-81572]

Immunocytochemistry/ Immunofluorescence: Kv6.1 Antibody [NBP1-81572]

Immunocytochemistry/Immunofluorescence: Kv6.1 Antibody [NBP1-81572] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Kv6.1 Antibody [NBP1-81572]

Immunohistochemistry-Paraffin: Kv6.1 Antibody [NBP1-81572]

Immunohistochemistry-Paraffin: Kv6.1 Antibody [NBP1-81572] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
View 1 more images

Applications for Kv6.1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kv6.1

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from bothfunctional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heartrate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cellvolume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantlyexpressed in skeletal muscle. Multiple alternatively spliced transcript variants have been found in normal andcancerous tissues. (provided by RefSeq)

Alternate Names

KCNG, KH2, kH2K13, Kv6.1, MGC12878, potassium channel KH2, potassium channel Kv6.1, potassium voltage-gated channel subfamily G member 1, potassium voltage-gated channel, subfamily G, member 1, Voltage-gated potassium channel subunit Kv6.1

Gene Symbol

KCNG1

Additional Kv6.1 Products

Product Documents for Kv6.1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Kv6.1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.