Lactoferrin Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38885

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38885
NBP2-38885-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Lactoferrin Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lactoferrin Antibody

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885] - Staining in human salivary gland and liver tissues using NBP2-38885 antibody. Corresponding LTF RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885] - Staining of human lactating breast shows strong positivity.
Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885] - Staining of human endometrium shows no positivity in glandular cells as expected.
View 3 more images

Applications for Lactoferrin Antibody

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lactoferrin

Lactoferrin is an iron binding glycoprotein with an approximate molecular weight of 80 kDa. The protein has two iron binding domains each housing one Fe3+ and the synergistic CO32- ion. The crystal structure form of human lactoferrin at 2.2A resolution exhibits 5330 protein atoms, 2Fe2+, 2CO32- and 98 carbohydrate atoms. Lactoferrin is absorbed from intestine by apical side of the membrane and localized to the nuclei. Intravenous infusion of lactoferrin is protective against lethal doses of E coli and induce bacterimia by a mechanism that downregulates neutrophil TNF alfa secretion. Recombinant human lactoferrin (rhLF), expressed and extracted from rice seed, is being evaluated for use as a dietary supplement to treat iron deficiency and/or iron deficiency induced anemia. Lactoferrin has been shown to have a role in the immune system and in early development of the embryo. A specific receptor for lactoferrin binding has been implicated in the human fetal intestine. Early embryonic localisation of lactoferrin by IHC has suggested its presence in various tissues including intestinal epitheliuem, kiney, and various regions of the brain.

Alternate Names

GIG12, HEL110, HLF2, Kaliocin-1, Lactoferricin, Lactoferroxin, Lactotransferrin, LF, LTF, Talalactoferrin

Gene Symbol

LTF

UniProt

P02788 (Human)

Additional Lactoferrin Products

Product Documents for Lactoferrin Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Lactoferrin Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.