Skip to main content

Laminin Antibody (CL3087) [Alexa Fluor® 700]

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-42389AF700

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-42389AF700

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Alexa Fluor 700 (Excitation = 675-700 nm, Emission = 723 nm)

Antibody Source

Recombinant Monoclonal Mouse IgG1 Clone # CL3087

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Laminin Antibody (CL3087) was made to a recombinant protein corresponding to amino acids: TVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVS

Reactivity Notes

Expected to cross react based on sequence identity: Mouse (89%). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal.  You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB.  Please contact Technical Support if you have any questions.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Applications for Laminin Antibody (CL3087) [Alexa Fluor® 700]

Application
Recommended Usage

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Laminin

Laminin, the most abundant structural and biologically active component in basement membranes, is a complex extracellular glycoprotein with high molecular weight (900 kDa). Laminin is composed of a laminin alpha (400 kDa), beta (215 kDa) and gamma chain (205 kDa), whose multidomain proteins are encoded by distinct genes (LAMA, LAMB, LAMC respectively) and have several isoforms of each chain. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, reflecting diverse functions in vivo. Laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.

Laminins are an important and biologically active part of the basal lamina, influencing cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis, where anti-laminin antibodies can be widely used to label blood vessels and basement membranes (1). Significant quantities of laminin are found in basement membranes, the thin extracellular matrices that surround epithelial tissue, nerve, fat cells and smooth, striated and cardiac muscle. Excessive serum laminin levels have been associated with fibrosis, cirrhosis and hepatitis, serious and frequent complications of chronic active liver disease characterized by excessive deposition of various normal components of connective tissue in liver (2). Epithelial mesenchymal transition (EMT) biomarkers include fibronectin, laminin, N-cadherin, and Slug (3).

References

1. Yang, M. Y., Chiao, M. T., Lee, H. T., Chen, C. M., Yang, Y. C., Shen, C. C., & Ma, H. I. (2015). An innovative three-dimensional gelatin foam culture system for improved study of glioblastoma stem cell behavior. J Biomed Mater Res B Appl Biomater, 103(3), 618-628. doi:10.1002/jbm.b.33214

2. Mak, K. M., & Mei, R. (2017). Basement Membrane Type IV Collagen and Laminin: An Overview of Their Biology and Value as Fibrosis Biomarkers of Liver Disease. Anat Rec (Hoboken), 300(8), 1371-1390. doi:10.1002/ar.23567

3. Choi, S., Yu, J., Park, A., Dubon, M. J., Do, J., Kim, Y., . . . Park, K. S. (2019). BMP-4 enhances epithelial mesenchymal transition and cancer stem cell properties of breast cancer cells via Notch signaling. Sci Rep, 9(1), 11724. doi:10.1038/s41598-019-48190-5

Alternate Names

LAMA, Laminin A chain, laminin subunit alpha-1, laminin, alpha 1, Laminin-1 subunit alpha, Laminin-3 subunit alpha, PTBHS, S-LAM alpha, S-laminin subunit alpha

Gene Symbol

LAMA1

Additional Laminin Products

Product Documents for Laminin Antibody (CL3087) [Alexa Fluor® 700]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Laminin Antibody (CL3087) [Alexa Fluor® 700]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...