Latrophilin 1/LPHN1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87717

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87717
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Latrophilin 1/LPHN1 Antibodies »

Product Summary for Latrophilin 1/LPHN1 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Latrophilin 1/LPHN1. Peptide sequence: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Latrophilin 1/LPHN1 Antibody

Western Blot: Latrophilin 1/LPHN1 Antibody [NBP2-87717]

Western Blot: Latrophilin 1/LPHN1 Antibody [NBP2-87717]

Western Blot: Latrophilin 1/LPHN1 Antibody [NBP2-87717] - WB Suggested Anti-LPHN1 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole Cell

Applications for Latrophilin 1/LPHN1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Latrophilin 1/LPHN1

Latrophilin-1 is a brain-specific Orphan-B Receptor that binds alpha-latrotoxin, a potent presynaptic neurotoxin present in the venom of the black widow spider, in a Ca2+-independent manner. As with the other two latrophilins, it shares homology with lectin, olfactomedin, and transmembrane domains, and possesses variable C-termini and various alternative-splicing sites. CIRL is endogenously cleaved into two pieces at the GPCR proteolytic site (GPS) located adjacent to the first transmembrane helix as a mechanism to compartmentalize the cell adhesion and GPCR activation functions. Latrophilin-1 has been reported to be expressed predominantly in the brain. Very weak expression has also been documented in human heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. ESTs have been isolated from brain, eye, kidney, lung, and lymph node libraries. In addition, ESTs have been isolated from the following cancer libraries: brain, choriocarcinoma, epithelioid carcinoma, kidney, and lung.

Alternate Names

CIRL1, LEC2, Lectomedin-2, LPHN1

Gene Symbol

ADGRL1

Additional Latrophilin 1/LPHN1 Products

Product Documents for Latrophilin 1/LPHN1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Latrophilin 1/LPHN1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.