LMOD1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89396

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89396
NBP1-89396-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all LMOD1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LMOD1 Antibody

Western Blot: LMOD1 Antibody [NBP1-89396]

Western Blot: LMOD1 Antibody [NBP1-89396]

Western Blot: LMOD1 Antibody [NBP1-89396] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: LMOD1 Antibody [NBP1-89396]

Immunocytochemistry/ Immunofluorescence: LMOD1 Antibody [NBP1-89396]

Immunocytochemistry/Immunofluorescence: LMOD1 Antibody [NBP1-89396] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396]

Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396]

Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human smooth muscle.
View 5 more images

Applications for LMOD1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMOD1

LMOD1, also known as Leiomodin-1, has a 600 amino acid long isoform that is 67 kDa and a short 572 amino acid that is 64 kDa, belongs to the tropomodulin family, most commonly found in smooth muscle (heart, skeletal muscle, colon and small intestine), and has a putative membrane-spanning region and 2 types of tandemly repeated blocks. Current research is being performed on several diseases and disorders including thyroiditis, autoimmune thyroiditis, eye disease, graves' disease, hyperthyroidism, goiter, adenoma, breast cancer, retinoblastoma, carcinoma, thyroid hormone metabolism, mccune albright syndrome, bullous pemphigoid thyrotoxicosis, papillary thyroid carcinoma, coronary restenosis, follicular thyroid carcinoma, iodine deficiency, systemic lupus erythematosus, and pituitary adenom Interactions with this protein have been shown to involve ACTB, MYH11, TLN1, TPM1 and VCL proteins in smooth muscle contraction and muscle contraction pathways.

Alternate Names

64 kDa autoantigen 1D, 64 kDa autoantigen 1D3,1D, 64 kDa autoantigen D1,64kD, D1, FLJ55689, leimodin 1 (smooth muscle), leiomodin 1 (smooth muscle), Leiomodin, muscle form, leiomodin-1, SM-Lmod, Smooth muscle leiomodin, thyroid and eye muscle autoantigen D1 (64kD), Thyroid-associated ophthalmopathy autoantigen

Gene Symbol

LMOD1

Additional LMOD1 Products

Product Documents for LMOD1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for LMOD1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.