LMP2/PSMB9 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-58331

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-58331
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all LMP2/PSMB9 Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human PSMB9 Peptide sequence RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: beta type-9.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for LMP2/PSMB9 Antibody

Western Blot: LMP2/PSMB9 Antibody [NBP1-58331]

Western Blot: LMP2/PSMB9 Antibody [NBP1-58331]

Western Blot: LMP2/PSMB9 Antibody [NBP1-58331] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Applications for LMP2/PSMB9 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMP2/PSMB9

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMB9 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This subunit is involved in antigen processing to generate class I binding peptides. Expression of PSMB9 is induced by gamma interferon and it replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding different isoforms have been identified; both isoforms are processed to yield the same mature subunit.

Long Name

Proteasome (Prosome, Macropain) Subunit, beta Type, 9

Alternate Names

Proteasome subunit beta-1i, PSMB9, RING12

Gene Symbol

PSMB9

UniProt

P28065 (Human)

Additional LMP2/PSMB9 Products

Product Documents for LMP2/PSMB9 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for LMP2/PSMB9 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.