LMP7/PSMB8 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-47396

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-47396
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all LMP7/PSMB8 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LMP7/PSMB8 Antibody

Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396]

Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396]

Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396] - Staining in human lymph node and pancreas tissues using anti-PSMB8 antibody. Corresponding PSMB8 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396]

Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396]

Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396] - Staining of human colon, kidney, liver and lymph node using Anti-PSMB8 antibody NBP2-47396 (A) shows similar protein distribution across tissues to independent antibody NBP2-47395 (B).
Western Blot: LMP7/PSMB8 Antibody [NBP2-47396]

Western Blot: LMP7/PSMB8 Antibody [NBP2-47396]

Western Blot: LMP7/PSMB8 Antibody [NBP2-47396] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue.
View 5 more images

Applications for LMP7/PSMB8 Antibody

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMP7/PSMB8

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit.

Long Name

Large Multifunctional Protease 7

Alternate Names

ALDD, D6S216E, JMP, NKJO, Proteasome Component C13, Proteasome Subunit Y2, PSMB5i, PSMB8, RING10

Gene Symbol

PSMB8

Additional LMP7/PSMB8 Products

Product Documents for LMP7/PSMB8 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for LMP7/PSMB8 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.