MAD2L1 Antibody (5W5U1)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15384

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15384-100ul
NBP3-15384-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5W5U1

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all MAD2L1 Antibodies »

Product Summary for MAD2L1 Antibody (5W5U1)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human MAD2L1 (Q13257). EQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MAD2L1 Antibody (5W5U1)

Western Blot: MAD2L1 Antibody (5W5U1) [NBP3-15384]

Western Blot: MAD2L1 Antibody (5W5U1) [NBP3-15384]

Western Blot: MAD2L1 Antibody (5W5U1) [NBP3-15384] - Western blot analysis of extracts of various cell lines, using MAD2/MAD2L1 Rabbit mAb (NBP3-15384) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: MAD2L1 Antibody (5W5U1) [NBP3-15384]

Immunohistochemistry-Paraffin: MAD2L1 Antibody (5W5U1) [NBP3-15384]

Immunohistochemistry-Paraffin: MAD2L1 Antibody (5W5U1) [NBP3-15384] - Immunohistochemistry of paraffin-embedded mouse kidney using MAD2/MAD2L1 Rabbit mAb (NBP3-15384) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: MAD2L1 Antibody (5W5U1) [NBP3-15384]

Immunohistochemistry-Paraffin: MAD2L1 Antibody (5W5U1) [NBP3-15384]

Immunohistochemistry-Paraffin: MAD2L1 Antibody (5W5U1) [NBP3-15384] - Immunohistochemistry of paraffin-embedded rat spleen using MAD2/MAD2L1 Rabbit mAb (NBP3-15384) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for MAD2L1 Antibody (5W5U1)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MAD2L1

The spindle checkpoint ensures the fidelity of chromosome segregation in mitosis and meiosis. In response to defects in the mitotic apparatus, it blocks the activity of the anaphase-promoting complex, a large ubiquitin ligase required for chromosome segregation. Recent studies indicate that the spindle checkpoint monitors both the attachment of chromosomes to the mitotic spindle and the tension across the sister chromatid generated by microtubules. Upon checkpoint activation, checkpoint protein complexes containing BubR1(Mad3), Bub3, Mad2 and Cdc20 directly bind to the anaphase-promoting complex and inhibit its ligase activity. Therefore, the checkpoint proteins form a complex intracellular signalling network to inhibit the anaphase-promoting complex.

Long Name

MAD2 Mitotic Arrest Deficient-Like 1

Alternate Names

HSMAD2

Gene Symbol

MAD2L1

Additional MAD2L1 Products

Product Documents for MAD2L1 Antibody (5W5U1)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MAD2L1 Antibody (5W5U1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.