MANF Antibody (1D10)

Novus Biologicals, part of Bio-Techne | Catalog # H00007873-M01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00007873-M01
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1D10

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all MANF Antibodies »

Product Specifications

Immunogen

ARMET (NP_006001.2, 116 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL

Specificity

Reacts with arginine-rich, mutated in early stage tumors.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for MANF Antibody (1D10)

Western Blot: MANF Antibody (1D10) [H00007873-M01]

Western Blot: MANF Antibody (1D10) [H00007873-M01]

Western Blot: MANF Antibody (1D10) [H00007873-M01] - Western Blot detection against Immunogen (33.33 KDa).
Immunocytochemistry/ Immunofluorescence: MANF Antibody (1D10) [H00007873-M01]

Immunocytochemistry/ Immunofluorescence: MANF Antibody (1D10) [H00007873-M01]

Immunocytochemistry/Immunofluorescence: MANF Antibody (1D10) [H00007873-M01] - Analysis of monclonal antibody to MANF antibody on HeLa cell. Image from verified customer review.
Immunocytochemistry/ Immunofluorescence: MANF Antibody (1D10) [H00007873-M01]

Immunocytochemistry/ Immunofluorescence: MANF Antibody (1D10) [H00007873-M01]

Immunocytochemistry/Immunofluorescence: MANF Antibody (1D10) [H00007873-M01] - Analysis of monoclonal antibody to MANF on HeLa cell . Antibody concentration 40 ug/ml.
View 1 more images

Applications for MANF Antibody (1D10)

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Reviewed Applications

Read 1 review rated 5 using H00007873-M01 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MANF

The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and promotes cell proliferation. The protein was initially thought to be longer at the N-terminus and to contain an arginine-rich region but transcribed evidence indicates a smaller open reading frame that does not encode the arginine tract. The presence of a specific mutation changing the previously numbered codon 50 from ATG to AGG, or deletion of that codon, has been reported in a variety of solid tumors. With the protein size correction, this codon is now identified as the initiation codon. [provided by RefSeq]

Long Name

Mesencephalic Astrocyte-derived Neurotrphic Factor

Alternate Names

ARMET, ARP

Entrez Gene IDs

7873 (Human)

Gene Symbol

MANF

UniProt

NP_006001 (Human)

Additional MANF Products

Product Documents for MANF Antibody (1D10)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MANF Antibody (1D10)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.