MED26 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-62629

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-62629
NBP2-62629-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all MED26 Antibodies »

Product Summary for MED26 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWT

Reactivity Notes

Mouse (88%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MED26 Antibody

Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629]

Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629]

Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629]

Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629]

Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629] - Immunohistochemistry analysis in human testis and endometrium tissues using Anti-MED26 antibody. Corresponding MED26 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629]

Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629]

Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629] - Staining of human endometrium shows low expression as expected.

Applications for MED26 Antibody

Application
Recommended Usage

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MED26

In mammalian cells, transcription is regulated in part by high molecular weight coactivating complexes that mediate signals between transcriptional activators and RNA polymerase. These complexes include CRSP (for cofactor required for Sp1 activation), which is required, in conjunction with TAFIIs, for transcriptional activation by Sp1. CRSP is ubiquitously expressed in various tissues and functions as a multimeric complex that consists of nine distinct subunits. Several members of the CRSP family share sequence similarity with multiple components of the yeast transcriptional mediator proteins, including CRSP150, which is related to yeast Rgr1, and CRSP70, which is similar to the elongation factor TFIIS. CRSP77 and CRSP150 are also related to proteins within the putative murine mediator complex, while CRSP130 and CRSP34 are largely unrelated to either murine or yeast proteins. CRSP subunits also associate with larger multimeric coactivaor complexes, including ARC/DRI, which binds directly to SREBP and nuclear hormone receptors to facilitate transcription, and with NAT, a polymerase II-interacting complex that represses activated transcription.

Alternate Names

Activator-recruited cofactor 70 kDa component, Cofactor required for Sp1 transcriptional activation subunit 7, cofactor required for Sp1 transcriptional activation, subunit 7 (70kD), cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa, CRSP70ARC70, CRSP7CRSP complex subunit 7, mediator complex subunit 26Transcriptional coactivator CRSP70, mediator of RNA polymerase II transcription subunit 26

Gene Symbol

MED26

Additional MED26 Products

Product Documents for MED26 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MED26 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.