MED27 Antibody (8B8)

Novus Biologicals, part of Bio-Techne | Catalog # H00009442-M01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00009442-M01
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 8B8

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all MED27 Antibodies »

Product Specifications

Immunogen

CRSP8 (AAH02878, 1 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL

Reactivity Notes

Human. Other species not tested.

Specificity

CRSP8 - cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for MED27 Antibody (8B8)

Western Blot: MED27 Antibody (8B8) [H00009442-M01]

Western Blot: MED27 Antibody (8B8) [H00009442-M01]

Western Blot: MED27 Antibody (8B8) [H00009442-M01] - CRSP8 monoclonal antibody (M01), clone 8B8 Analysis of CRSP8 expression in Hela S3 NE.
Immunohistochemistry-Paraffin: MED27 Antibody (8B8) [H00009442-M01]

Immunohistochemistry-Paraffin: MED27 Antibody (8B8) [H00009442-M01]

Immunohistochemistry-Paraffin: MED27 Antibody (8B8) [H00009442-M01] - Analysis of monoclonal antibody to CRSP8 on formalin-fixed paraffin-embedded human colon. Antibody concentration 0.3 ug/ml.
Western Blot: MED27 Antibody (8B8) [H00009442-M01]

Western Blot: MED27 Antibody (8B8) [H00009442-M01]

Western Blot: MED27 Antibody (8B8) [H00009442-M01] - Analysis of CRSP8 expression in transfected 293T cell line by CRSP8 monoclonal antibody (M01), clone 8B8.Lane 1: CRSP8 transfected lysate(35.4 KDa).Lane 2: Non-transfected lysate.
View 1 more images

Applications for MED27 Antibody (8B8)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin).

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MED27

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

Alternate Names

cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa, CRSP34CRSP complex subunit 8, CRSP8CRAP34, mediator complex subunit 27Transcriptional coactivator CRSP34, mediator of RNA polymerase II transcription subunit 27, MGC11274, P37 TRAP/SMCC/PC2 subunit, subunit 8 (34kD), TRAP37

Entrez Gene IDs

9442 (Human)

Gene Symbol

MED27

OMIM

605044 (Human)

UniProt

AAH02878 (Human)

Additional MED27 Products

Product Documents for MED27 Antibody (8B8)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MED27 Antibody (8B8)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.