MED27 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10307

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10307-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all MED27 Antibodies »

Product Summary for MED27 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MED27 (NP_004260). Peptide sequence LSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLD

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MED27 Antibody

Western Blot: MED27 Antibody [NBP3-10307]

Western Blot: MED27 Antibody [NBP3-10307]

Western Blot: MED27 Antibody [NBP3-10307] - Western blot analysis using NBP3-10307 on Human Brain as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for MED27 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MED27

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

Alternate Names

cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa, CRSP34CRSP complex subunit 8, CRSP8CRAP34, mediator complex subunit 27Transcriptional coactivator CRSP34, mediator of RNA polymerase II transcription subunit 27, MGC11274, P37 TRAP/SMCC/PC2 subunit, subunit 8 (34kD), TRAP37

Gene Symbol

MED27

Additional MED27 Products

Product Documents for MED27 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MED27 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.