Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-03633

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-03633-100ul
NBP3-03633-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Melatonin R1A/MT1/MTNR1A Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 281-350 of human Melatonin R1A/MT1/MTNR1A (NP_005949.1). YYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free [NBP3-03633]

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free [NBP3-03633]

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Mouse brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free [NBP3-03633]

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free [NBP3-03633]

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Rat brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).
Melatonin R1A/MT1/MTNR1A Antibody

Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] -

Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - analysis of Mouse eye, using MTNR1A antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

Applications for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:100-1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Melatonin R1A/MT1/MTNR1A

Melatonin Receptor 1A encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin. [provided by RefSeq]

Long Name

Melatonin Receptor 1A

Alternate Names

Mel-1A-R, MelatoninR1A, MT1, MTNR1A

Gene Symbol

MTNR1A

Additional Melatonin R1A/MT1/MTNR1A Products

Product Documents for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.