Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16193

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16193-100ul
NBP3-16193-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5U2F4

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Methionine Aminopeptidase 2/METAP2 Antibodies »

Product Summary for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 380-478 of human Methionine Aminopeptidase 2/METAP2 (NP_006829.1). CSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193] - Western blot analysis of extracts of Rat testis, using Methionine Aminopeptidase 2/METAP2 Rabbit mAb (NBP3-16193) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193] - Western blot analysis of extracts of various cell lines, using Methionine Aminopeptidase 2/METAP2 Rabbit mAb (NBP3-16193) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

Application
Recommended Usage

Western Blot

1:1000 - 1:5000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Methionine Aminopeptidase 2/METAP2

METAP2 is a member of the methionyl aminopeptidase family and encodes a protein that binds 2 cobalt or manganese ions. This protein functions both by protecting the alpha subunit of eukaryotic initiation factor 2 from inhibitory phosphorylation and by removing the amino-terminal methionine residue from nascent protein. Increased expression of this gene is associated with various forms of cancer and the anti-cancer drugs fumagillin and ovalicin inhibit the protein by irreversibly binding to its active site. A pseudogene of this gene is located on chromosome 2. [provided by RefSeq]

Alternate Names

Amp2, METAP2, MNPEP, p67eIF2

Gene Symbol

METAP2

Additional Methionine Aminopeptidase 2/METAP2 Products

Product Documents for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.