Methionine Sulfoxide Reductase B Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-03548

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-03548-100ul
NBP3-03548-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Methionine Sulfoxide Reductase B Antibodies »

Product Summary for Methionine Sulfoxide Reductase B Antibody - BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-94 of human Methionine Sulfoxide Reductase B (NP_057416.1). MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Methionine Sulfoxide Reductase B Antibody - BSA Free

Western Blot: Methionine Sulfoxide Reductase B AntibodyBSA Free [NBP3-03548]

Western Blot: Methionine Sulfoxide Reductase B AntibodyBSA Free [NBP3-03548]

Western Blot: Methionine Sulfoxide Reductase B Antibody [NBP3-03548] - Analysis of extracts of various cell lines, using Methionine Sulfoxide Reductase B antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase B Antibody - BSA Free [NBP3-03548]

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase B Antibody - BSA Free [NBP3-03548]

Immunocytochemistry/Immunofluorescence: Methionine Sulfoxide Reductase B Antibody [NBP3-03548] - Analysis of HeLa cells using Methionine Sulfoxide Reductase B antibody . Blue: DAPI for nuclear staining.

Applications for Methionine Sulfoxide Reductase B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Western Blot

1:500-1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Methionine Sulfoxide Reductase B

Methionine Sulfoxide Reductase B encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein belongs to the methionine sulfoxide reductase B (MsrB) family, and it is expressed in a variety of adult and fetal tissues.

Alternate Names

EC 1.8.4.-, methionine sulfoxide reductase, methionine-R-sulfoxide reductase B1, MGC3344, MsrB1, MSRB1selenoprotein R, Selenoprotein X, selenoprotein X, 1, SELR, SelX

Gene Symbol

MSRB1

Additional Methionine Sulfoxide Reductase B Products

Product Documents for Methionine Sulfoxide Reductase B Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Methionine Sulfoxide Reductase B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.