Microsomal Glutathione S-transferase 1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85283

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85283-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Microsomal Glutathione S-transferase 1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Microsomal Glutathione S-transferase 1. Peptide sequence: NPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Microsomal Glutathione S-transferase 1 Antibody

Western Blot: Microsomal Glutathione S-transferase 1 Antibody [NBP2-85283]

Western Blot: Microsomal Glutathione S-transferase 1 Antibody [NBP2-85283]

Western Blot: Microsomal Glutathione S-transferase 1 Antibody [NBP2-85283] - WB Suggested Anti-MGST1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Liver

Applications for Microsomal Glutathione S-transferase 1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Microsomal Glutathione S-transferase 1

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Four transcript variants of this gene encode one protein isoform. [provided by RefSeq]

Alternate Names

glutathione S-transferase 12, GST12EC 2.5.1.18, MGC14525, MGST, MGST-I, microsomal glutathione S-transferase 1, Microsomal GST-1, Microsomal GST-I

Gene Symbol

MGST1

Additional Microsomal Glutathione S-transferase 1 Products

Product Documents for Microsomal Glutathione S-transferase 1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Microsomal Glutathione S-transferase 1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.