MID2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82286

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-82286-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all MID2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MID2. Peptide sequence: WGLWPEIRKCKEAVSCSRLAGAPRGLYNSVDSWMIVPNIKQNHYTVHGLQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MID2 Antibody

Western Blot: MID2 Antibody [NBP2-82286]

Western Blot: MID2 Antibody [NBP2-82286]

Western Blot: MID2 Antibody [NBP2-82286] - Host: Rabbit. Target Name: MID2. Sample Type: NCI-H226 Whole Cell lysates. Antibody Dilution: 1.0ug/mlMID2 is supported by BioGPS gene expression data to be expressed in NCIH226

Applications for MID2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MID2

MID2 is a member of the tripartite motif (TRIM) family. The MID motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to microtubular structures in the cytoplasm. Its function has not been identified. Alternate splicing of the gene encoding MID2 results in two transcript variants encoding different isoforms.

Alternate Names

EC 6.3.2.-, FLJ37715, FLJ41813, FXY2midin-2, midin 2, Midin-2, midline 2, Midline defect 2, Midline-2, RING finger protein 60, RNF60midline-2, TRIM1probable E3 ubiquitin-protein ligase MID2, tripartite motif protein 1, Tripartite motif-containing protein 1

Gene Symbol

MID2

Additional MID2 Products

Product Documents for MID2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MID2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.