MLC1SA Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-92124

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-92124
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all MLC1SA Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: APPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MLC1SA Antibody

Western Blot: MLC1SA Antibody [NBP1-92124]

Western Blot: MLC1SA Antibody [NBP1-92124]

Western Blot: MLC1SA Antibody [NBP1-92124] - Analysis in control (vector only transfected HEK293T lysate) and MYL6B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MLC1SA Antibody [NBP1-92124]

Immunocytochemistry/ Immunofluorescence: MLC1SA Antibody [NBP1-92124]

Immunocytochemistry/Immunofluorescence: MLC1SA Antibody [NBP1-92124] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]

Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]

Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124] - Staining in human skeletal muscle and duodenum tissues using anti-MYL6B antibody. Corresponding MYL6B RNA-seq data are presented for the same tissues.
View 3 more images

Applications for MLC1SA Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20-1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MLC1SA

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. [provided by RefSeq]

Alternate Names

MLC1sa, MLC1SAmyosin light chain 1, slow-twitch muscle A isoform, myosin alkali light chain 1 slow a, myosin light chain 1 slow a, Myosin light chain 1 slow-twitch muscle A isoform, myosin light chain 6B, myosin, light chain 6B, alkali, smooth muscle and non-muscle, myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle, smooth muscle and non-muscle myosin alkali light chain 6B, Smooth muscle and nonmuscle myosin light chain alkali 6B

Gene Symbol

MYL6B

Additional MLC1SA Products

Product Documents for MLC1SA Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MLC1SA Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.