MOCS2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-81045

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-81045
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all MOCS2 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MOCS2 Antibody

Western Blot: MOCS2 Antibody [NBP1-81045]

Western Blot: MOCS2 Antibody [NBP1-81045]

Western Blot: MOCS2 Antibody [NBP1-81045] - Analysis in control (vector only transfected HEK293T lysate) and MOCS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MOCS2 Antibody [NBP1-81045]

Immunocytochemistry/ Immunofluorescence: MOCS2 Antibody [NBP1-81045]

Immunocytochemistry/Immunofluorescence: MOCS2 Antibody [NBP1-81045] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: MOCS2 Antibody [NBP1-81045]

Immunohistochemistry-Paraffin: MOCS2 Antibody [NBP1-81045]

Immunohistochemistry-Paraffin: MOCS2 Antibody [NBP1-81045] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Applications for MOCS2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MOCS2

Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. [provided by RefSeq]

Alternate Names

EC 2.-, MCBPE, MOCO1-A, MOCO1-B, MOCO1MOCS2B, MOCS2A, molybdenum cofactor biosynthesis protein E, molybdenum cofactor synthesis 2, Molybdenum cofactor synthesis protein 2 large subunit, Molybdenum cofactor synthesis protein 2 small subunit, Molybdenum cofactor synthesis protein 2A, Molybdenum cofactor synthesis protein 2B, molybdopterin synthase catalytic subunit, molybdopterin synthase sulfur carrier subunit, Molybdopterin-synthase large subunit, Molybdopterin-synthase small subunit, MPT synthase large subunit, MPTS, Sulfur carrier protein MOCS2A

Entrez Gene IDs

4338 (Human)

Gene Symbol

MOCS2

UniProt

O96033 (Human)

Additional MOCS2 Products

Product Documents for MOCS2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MOCS2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.