MPP3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85014

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-85014
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all MPP3 Antibodies »

Product Summary for MPP3 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SQDDPTWWQAKRVGDTNLRAGLIPSKGFQERRLSYRRAAGTLPSPQSLRKPPYDQPCDKETCDCEGYLKGHYVAGL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MPP3 Antibody

Western Blot: MPP3 Antibody [NBP1-85014]

Western Blot: MPP3 Antibody [NBP1-85014]

Western Blot: MPP3 Antibody [NBP1-85014] - Analysis in control (vector only transfected HEK293T lysate) and MPP3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MPP3 Antibody [NBP1-85014]

Immunocytochemistry/ Immunofluorescence: MPP3 Antibody [NBP1-85014]

Immunocytochemistry/Immunofluorescence: MPP3 Antibody [NBP1-85014] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014]

Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014]

Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014] - Staining of human liver shows no in hepatocytes as expected.
View 3 more images

Applications for MPP3 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MPP3

MPP3 product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. This protein contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction. Alternatively spliced transcript variants have been identified. One transcript variant is experimentally supported, but it doesn't encode a protein.

Alternate Names

Discs large homolog 3, discs, large homolog 3, DLG3MAGUK p55 subfamily member 3, membrane protein palmitoylated 3, membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3), Protein MPP3

Gene Symbol

MPP3

Additional MPP3 Products

Product Documents for MPP3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MPP3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.