MRCL3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86713

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86713
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all MRCL3 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human MRCL3. Peptide sequence: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MRCL3 Antibody

Western Blot: MRCL3 Antibody [NBP2-86713]

Western Blot: MRCL3 Antibody [NBP2-86713]

Western Blot: MRCL3 Antibody [NBP2-86713] - Host: Rabbit. Target Name: MYL12A. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for MRCL3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRCL3

The muscle myosins and hexomeric proteins consisting of two heavy chains and two pairs of light chains, the latter called essential (ELC) and regulatory (RLC). The light chains stabilize the long alpha helical neck of the myosin head (1). Human myosin light chain-2 (MYL2) is an important protein involved in the regulation of myosin ATPase activity in smooth muscle. In cardiac muscle, the precise role of MYL2 is not well understood; however, an increase in ventricular MYL2 is observed during myocardial hypertrophy in cardiac patients with valve stenosis (2). Familial hypertrophic cardiomyopathy (FHC) is an autosomal dominant disease caused by mutations in all of the major sarcomeric proteins, including the ventricular myosin regulatory light-chain (RLC). The Myosin RLC mutation has been associated with a rare variant of cardiac hypertrophy defined by mid-left ventricular obstruction due to papillary muscle hypertrophy. This mutation was later found to cause ventricular and septal hypertrophy (3).

Alternate Names

MLCBMyosin RLC, MRCL3, MRLC3MLC-2B, MYL2B, myosin regulatory light chain 12A, Myosin regulatory light chain 2, nonsarcomeric, myosin regulatory light chain 3, myosin regulatory light chain MRCL3, Myosin regulatory light chain MRLC3, myosin, light chain 12A, regulatory, non-sarcomeric, myosin, light polypeptide, regulatory, non-sarcomeric (20kD), RLC

Gene Symbol

MYL12A

Additional MRCL3 Products

Product Documents for MRCL3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MRCL3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.