MRPS26 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56855

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-56855
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all MRPS26 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KALKDAAEHRELMAWNQAENRRLHELRIARLRQEEREQEQRQALEQARKAEEVQAWAQRKERE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPS26 Antibody

Western Blot: MRPS26 Antibody [NBP2-56855]

Western Blot: MRPS26 Antibody [NBP2-56855]

Western Blot: MRPS26 Antibody [NBP2-56855] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: MRPS26 Antibody [NBP2-56855]

Immunocytochemistry/ Immunofluorescence: MRPS26 Antibody [NBP2-56855]

Immunocytochemistry/Immunofluorescence: MRPS26 Antibody [NBP2-56855] - Staining of human cell line U-2 OS shows localization to mitochondria.

Applications for MRPS26 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPS26

MRPS26, also known as Mitochondrial Ribosomal Protein S26, consists of a 205 amino acid isoform that is 24 kDa, and is involved in protein synthesis, though its specific function within the process is unknown. Current research is currently being conducted on the between MRPS26 and a variety of diseases and disorders, including Dubin-Johnson syndrome, gout, and breast cancer. MRPS26 has been linked to the DNA damage response and the peptide biosynthetic process, through which it interacts with several proteins, such as ICT1, PPP2CA, USP42, LMNA, and KBTBD7.

Alternate Names

C20orf193, dJ534B8.3, GI008,28S ribosomal protein S13, mitochondrial, mitochondrial ribosomal protein S26, MRP-S13MRPS13, MRP-S26chromosome 20 open reading frame 193, NY-BR-87, RPMS1328S ribosomal protein S26, mitochondrial, S13mt, S26mt, serologically defined breast cancer antigen NY-BR-87

Gene Symbol

MRPS26

Additional MRPS26 Products

Product Documents for MRPS26 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MRPS26 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.