MST3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87834

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87834
NBP1-87834-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all MST3 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MST3 Antibody

Western Blot: MST3 Antibody [NBP1-87834]

Western Blot: MST3 Antibody [NBP1-87834]

Western Blot: MST3 Antibody [NBP1-87834] - Analysis using Anti-STK24 antibody NBP1-87834 (A) shows similar pattern to independent antibody NBP1-87833 (B).
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Western Blot: MST3 Antibody [NBP1-87834]

Western Blot: MST3 Antibody [NBP1-87834]

Western Blot: MST3 Antibody [NBP1-87834] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
View 9 more images

Applications for MST3 Antibody

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MST3

The growth of axons is fundamental to the development and repair of brain circuitry. It has been shown that Mst3, a neuron-specific homolog of the yeast kinase Ste20, is critical for axon outgrowth. Mst3 is activated in response to trophic factors, and suppressing its expression or its function blocks axon outgrowth (1). Mst3 has been recently demonstrated to undergo a caspase-mediated cleavage during apoptosis. The proteolytic cleavage of the C-terminus of Mst3 caused nuclear translocation of its kinase domain. Mst3 contains both nuclear localization sequence (NLS) and NES signals, which may cooperate to control the subcellular distribution of Mst3 (2). In situ hybridization of rat brain sections indicated that MST3b is widely expressed in different brain regions, with especially high expression in hippocampus and cerebral cortex. When expressed in human embryonic kidney 293 (HEK293) cells, MST3b effectively phosphorylated myelin basic protein, as well as undergoing autophosphorylation (3)

Alternate Names

EC 2.7.11, EC 2.7.11.1, Mammalian STE20-like protein kinase 3, MST-3, MST3serine/threonine kinase 24 (Ste20, yeast homolog), serine/threonine kinase 24, serine/threonine-protein kinase 24, STE20, STE20-like kinase 3, STE20-like kinase MST3, sterile 20-like kinase 3, STK3yeast)

Gene Symbol

STK24

Additional MST3 Products

Product Documents for MST3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MST3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.