MTA2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87853

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87853
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all MTA2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MTA2. Peptide sequence: KDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MTA2 Antibody

Western Blot: MTA2 Antibody [NBP2-87853]

Western Blot: MTA2 Antibody [NBP2-87853]

Western Blot: MTA2 Antibody [NBP2-87853] - Host: Rabbit. Target Name: MTA2. Sample Tissue: Human ACHN Whole Cell. Antibody Dilution: 1ug/ml

Applications for MTA2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTA2

Official Gene Symbol: MTA2 Gen Bank Accession Number: NP_004730 Gene ID: 9219 (Human) Gene Map Locus: 11q12-q13.1 (human) MTA2, a homologue of human MTA1 and MTA3, is a member of highly conserved MTA gene family. It is a component of NuRD, an ATP-dependent nucleosome remodeling and histone deacetylase complex. MTA2 is a nuclear protein that interacts with HDAC1 and HDAC2 and has a functional role in chromatin remodeling and deacetylase activity. MTA2 specifically interacts with p53 and represses p53-dependant transcriptional activation, thereby regulating p53-mediated cell growth arrest and apoptosis. It also inhibits the transcriptional activity of Estrogen receptor-alpha. Northern Blot analysis detected a ubiquitous expression of MTA2.

Alternate Names

DKFZp686F2281, metastasis associated 1 family, member 2, metastasis -associated gene 1-like 1, metastasis associated gene family, member 2, Metastasis-associated 1-like 1, metastasis-associated protein 2, metastasis-associated protein MTA2, MTA1-L1 protein, MTA1L1MTA1-L1, p53 target protein in deacetylase complex, PID

Gene Symbol

MTA2

Additional MTA2 Products

Product Documents for MTA2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MTA2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.