MTHFD1L Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57852

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-57852
NBP2-57852-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Simple Western, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all MTHFD1L Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKVGCGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MTHFD1L Antibody

Western Blot: MTHFD1L Antibody [NBP2-57852]

Western Blot: MTHFD1L Antibody [NBP2-57852]

Western Blot: MTHFD1L Antibody [NBP2-57852] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: MTHFD1L Antibody [NBP2-57852]

Immunocytochemistry/ Immunofluorescence: MTHFD1L Antibody [NBP2-57852]

Immunocytochemistry/Immunofluorescence: MTHFD1L Antibody [NBP2-57852] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.
Simple Western: MTHFD1L Antibody [NBP2-57852]

Simple Western: MTHFD1L Antibody [NBP2-57852]

Simple Western: MTHFD1L Antibody [NBP2-57852] - Human U251 glioma cell line; whole cell lysate. Antibody at 1:250, 0.08 ug/uL total protein. Simple Western image submitted by a verified customer review.

Applications for MTHFD1L Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/mL

Western Blot

0.04 - 0.4 ug/mL
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. This MTHFD1L Antibody is validated for Simple Western from a verified customer review.

Reviewed Applications

Read 1 review rated 4 using NBP2-57852 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTHFD1L

MTHFD1L, also known as Monofunctional C1-tetrahydrofolate synthase, mitochondrial, consists of 2 a 978 amino acid isoform1 that is 106 kDa and a 275 amino acid isoform 2 that is 30 kDa; has mitochondrion subcellular location and highest expression found in placenta, thymus and brain; it is involved in the synthesis of tetrahydrofolate (THF) in the mitochondrion which is important in the de novo synthesis of purines and thymidylate and in the regeneration of methionine from homocysteine, and also may provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2. Current research is being performed on this protein involvement in cleft lip/palate, neural tube defect, homocysteine, coronary heart disease, chronic myeloid leukemia, Down syndrome, colon adenocarcinoma, nephropathy, Alzheimer's disease, dementia, colorectal cancer, leukemia, and atherosclerosis. This protein plays role in One carbon pool by folate and Metabolic pathways where it interacts with CASP4, MAGED1, WRAP73, WDR8, MAP1LC3A, and plus more than 40 other proteins.

Alternate Names

10-formyl-THF synthetase, dJ292B18.2, DKFZP586G1517, EC 6.3.4.3, FLJ21145, Formyltetrahydrofolate synthetase, formyltetrahydrofolate synthetase domain containing 1, FTHFSDC1, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like, mitochondrial C1-tetrahydrofolate synthase, mitochondrial C1-tetrahydrofolate synthetase, monofunctional C1-tetrahydrofolate synthase, mitochondrial, MTC1THFS

Gene Symbol

MTHFD1L

Additional MTHFD1L Products

Product Documents for MTHFD1L Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MTHFD1L Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.