Muscleblind-like 1 Antibody (7N6W3)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16574

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16574-100ul
NBP3-16574-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7N6W3

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Muscleblind-like 1 Antibodies »

Product Summary for Muscleblind-like 1 Antibody (7N6W3)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 289-388 of human Muscleblind-like 1 (Q9NR56). IPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Muscleblind-like 1 Antibody (7N6W3)

Western Blot: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574]

Western Blot: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574]

Western Blot: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574] - Western blot analysis of extracts of various cell lines, using Muscleblind-like 1 Rabbit mAb (NBP3-16574) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574]

Immunocytochemistry/ Immunofluorescence: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574]

Immunocytochemistry/Immunofluorescence: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574] - Immunofluorescence analysis of U-2 OS cells using Muscleblind-like 1 Rabbit mAb (NBP3-16574) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Muscleblind-like 1 Antibody (7N6W3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Muscleblind-like 1

Several important human diseases are associated with expansion of polynucleotide sequences, in most cases trinucleotide repeats. Myotonic dystrophy (DM1) is one of these diseases, and is associated with increases in the number of CTG repeats in the UTR of the gene encoding myotonin (a.k.a. DM Kinase, DMK or myotonin-Protein Kinase), a ser/thr kinase expressed specifically in muscle. Mammalian genomes contain three muscleblind-like proteins, generally referred to as MBNL1, MBNL2 and MBNL3, and all three were found to associate with long double stranded CUG RNA repeats, thus, being triplet repeat expansion dsRNA-binding proteins.

Alternate Names

DKFZp686P06174, EXP40, EXP42, EXPKIAA0428EXP35, MBNL, muscleblind (Drosophila)-like, muscleblind-like (Drosophila), muscleblind-like protein 1, Triplet-expansion RNA-binding protein

Gene Symbol

MBNL1

Additional Muscleblind-like 1 Products

Product Documents for Muscleblind-like 1 Antibody (7N6W3)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Muscleblind-like 1 Antibody (7N6W3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.