Musculin Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56244

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-56244
NBP2-56244-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Musculin Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNS

Reactivity Notes

Rat 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Musculin Antibody

Western Blot: Musculin Antibody [NBP2-56244]

Western Blot: Musculin Antibody [NBP2-56244]

Western Blot: Musculin Antibody [NBP2-56244] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: Musculin Antibody [NBP2-56244]

Immunocytochemistry/ Immunofluorescence: Musculin Antibody [NBP2-56244]

Immunocytochemistry/Immunofluorescence: Musculin Antibody [NBP2-56244] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.

Applications for Musculin Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Musculin

Differentiation of myogenic cells is regulated by multiple positively and negatively acting factors. One well characterized family of helix-loop-helix (HLH) proteins, known to play an important role in the regulation of muscle cell development, includes MyoD, myogenin and musculin (also designated MyoR). Members of this group of transcription factors form heterodimers with products of a more widely expressed family of bHLH genes, the E family, which consists of at least three distinct genes: E2A, IF2 and HEB. MyoD-E or musculin-E heterodimers bind avidly to consensus E box motifs, which are functionally important elements in the promoter regions of many musclespecific terminal differentiation genes. MyoD complexes potently induce transcriptional activation, while musculin complexes bind adjacent to MyoD DNA-binding regions to represses MyoD activity, which then results in the delayed expression of muscle-specific genes. Musculin is highly expressed in undifferentiated and proliferating myoblasts in culture, and its expression is down regulated during myogenesis and at the onset of terminal differentiation

Alternate Names

ABF1, ABF-1activated B-cell factor 1, homolog of mouse musculin, Activated B-cell factor 1, BHLHA22, bHLHa22activated B-cell factor-1, Class A basic helix-loop-helix protein 22, musculin, musculin (activated B-cell factor-1), MYOR

Gene Symbol

MSC

Additional Musculin Products

Product Documents for Musculin Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Musculin Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.